132402-BIOTIN
RBM8A (RNA-binding Protein 8A, Binder of OVCA1-1, BOV-1, RNA-binding Motif Protein 8A, RNA-binding Protein Y14, Ribonucleoprotein RBM8A, RBM8, HSPC114, MDS014) (Biotin)
Größe
£914.00
- SKU:
- 132402-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-174 from RBM8A (AAH17088) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3E4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- RBM8A is a member of the EJC (The exon junction complex) that is involved in mRNA export, cytoplasmic localization and nonsense mediated mRNA decay. This protein has the ability to communicate to the cytoplasm the processing history of the mRNA, including the position of the removed introns. Although it shuttles to the cytoplasm, it is predominantly detected in the nucleus and is colocalized with oskar mRNA at the posterior pole of the cell. Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILSVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice