RBM6 (RNA-binding Protein 6, Lung Cancer Antigen NY-LU-12, Protein G16, RNA-binding Motif Protein 6, RNA-binding Protein DEF-3, DEF3)

Größe

£685.00

SKU:: 132401
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1024-1123 from RBM6 (NP_005768) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3E9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: RBM6 contains one G-patch domain and one RRM (RNA recognition motif) domain. It specifically binds poly(G) RNA homopolymers in vitro and is ubiquitously expressed in adults. Defects in RBM6 are found in non-small cell lung cancer (NSCLC) cell lines. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKRQSNETYRDAVRRVMFARYKELD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.