RASGRP3 (Ras Guanyl-releasing Protein 3, Calcium and DAG-regulated Guanine Nucleotide Exchange Factor III, GRP3, Guanine Nucleotide Exchange Factor for Rap1, KIAA0846)

Größe

£685.00

SKU:: 132346
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-99 from RASGRP3 (NP_733772) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1H4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYRNATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMT* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.