132327-ML490
RARRES3 (Retinoic Acid Receptor Responder Protein 3, RAR-responsive Protein TIG3, Retinoid-inducible Gene 1 Protein, Tazarotene-induced Gene 3 Protein, RIG1, TIG3, MGC8906) (MaxLight 490)
Größe
£914.00
- SKU:
- 132327-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to human RARRES3, aa1-165 (AAH09678) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1H5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. RARRES3 also called Tig3 or RIG1 is an 18kD, 164aa cytoplasmic protein within the LRAT family of growth inhibitory proteins, which are class II tumor-suppressors. RARRES3 is expressed in a variety of cells including epidermal keratinocytes, and may be downregulated in tumor cells and cell lines. It shows phospholipase activity and interaction with type I transglutaminase. A C-terminal hydrophobic region allows perinuclear localization. RARRES3 is not structurally related to other RARRES genes. A canine ortholog shares 72% aa identity within the region used as an immunogen; orthologs are unlikely in rodents. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice