132326
RARRES3 (Retinoic Acid Receptor Responder Protein 3, RAR-responsive Protein TIG3, Retinoid-inducible Gene 1 Protein, Tazarotene-induced Gene 3 Protein, RIG1, TIG3, MGC8906)
Größe
£685.00
- SKU:
- 132326
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human RARRES3, aa1-164 (AAH09678.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- RARRES3 also called Tig3 or RIG1 is an 18kD, 164aa cytoplasmic protein within the LRAT family of growth inhibitory proteins, which are class II tumor-suppressors. RARRES3 is expressed in a variety of cells including epidermal keratinocytes, and may be downregulated in tumor cells and cell lines. It shows phospholipase activity and interaction with type I transglutaminase. A C-terminal hydrophobic region allows perinuclear localization. RARRES3 is not structurally related to other RARRES genes. A canine ortholog shares 72% aa identity within the region used as an immunogen; orthologs are unlikely in rodents. Applications: Suitable for use in Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice