RAPGEF3 (CGEF1, EPAC, EPAC1, Rap Guanine Nucleotide Exchange Factor 3, Exchange Factor Directly Activated by cAMP 1, Exchange Protein Directly Activated by cAMP 1, Rap1 Guanine-nucleotide-exchange Factor Directly Activated by cAMP, cAMP-regulated Guanine Nucleotide Exchange Factor I)

Größe

£685.00

SKU:: 132310
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa772-881 from RAPGEF3 (AAH17728) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2E5
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Guanine nucleotide exchange factor (GEF) for RAP1A and RAP2A small GTPases that is activated by binding cAMP. Applications: Suitable for use in Western Blot and ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FMPLLLKDMTFIHEGNHTLVENLINFEKMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWAYVQQLKVIDNQRELSRLSRELEP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.