132298-BIOTIN
RANBP3 (RAN Binding Protein 3, DKFZp586I1520) (Biotin)
Größe
£914.00
- SKU:
- 132298-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa298-397 from ANBP3 (AAH04349) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2E10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- RanBP3 was originally identified as RanGTP binding protein located in the nucleus and involved in the nuclear exporting process. It functions as a cofactor for CRM1 nuclear export by binding to CRM1, stabilizing the RanGTP-CRM1-cargo interaction and promoting complex association with nuclear pore proteins. In the absence of Ran-bound GTP, RanBP3 prevents binding of CRM1 complex to the nuclear pore complex. In addition to CRM1, RanBP3 also has been shown to bind to RanGEF-RCC1 and increase the guanine nucleotide exchange activity of RCC1 for RanGTP-CRM1-Cargo. In some cases, as with B-catenin and Smad2/3, RanBP3 binding may mediate the target protein nuclear export in a Ran-dependent, but CRM1-independent manner. RanBP3 is phosphorylated at Ser58 through the PI3K/Akt or ERK/RSK pathway. This phosphorylation is important for RanBP3 function in nuclear export, likely due to stimulation of RCC1 activity. Applications: Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA sequence: KESLAESAAAYTKATARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWLLRHPHPSHPAVGPCLCGEQPALCPCPGLPNYRPGTPAQLGGLLVRV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice