132296-ML650
RAMP3 (Receptor Activity-modifying Protein 3, Calcitonin-receptor-like Receptor Activity-modifying Protein 3, CRLR Activity-modifying Protein 3) (MaxLight 650)
Größe
£914.00
- SKU:
- 132296-ML650
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant protein corresponding to aa24-148 of human RAMP3 (AAH22304; BC022304) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1C11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Weitere Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. RAMP3 (receptor calcitonin activity modifying protein 3) transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. It acts as a receptor for adrenomedullin (AM) together with CALCRL. It is strongly expressed in lung, breast, immune system and fetal tissues and belongs to the RAMP family. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice