132295
RAMP3 (Receptor Activity-modifying Protein 3, Calcitonin-receptor-like Receptor Activity-modifying Protein 3, CRLR Activity-modifying Protein 3)
Größe
£685.00
- SKU:
- 132295
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human RAMP3, aa1-148 (NP_005847.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- RAMP3 (receptor calcitonin activity modifying protein 3) transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. It acts as a receptor for adrenomedullin (AM) together with CALCRL. It is strongly expressed in lung, breast, immune system and fetal tissues and belongs to the RAMP family. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice