132288-APC

RALGDS (Ral Guanine Nucleotide Dissociation Stimulator, RalGDS, Ral Guanine Nucleotide Exchange Factor, RalGEF, KIAA1308, RGF, FLJ20922) (APC)

Größe

£927.00

SKU:: 132288-APC
Anwendung:: FLISA
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa793-902, from human RALGDS (AAH59362) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1A11
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: Stimulates the dissociation of GDP from the Ras-related RalA and RalB GTPases which allows GTP binding and activation of the GTPases. Interacts and acts as an effector molecule for R-Ras, H-Ras, K-Ras, and Rap. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLPRMKQKGLKIAKGIF Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.