132235-BIOTIN

RABGAP1 (Rab GTPase-activating Protein 1, GAP and Centrosome-associated Protein, Rab6 GTPase-activating Protein GAPCenA) (Biotin)

Größe

£914.00

SKU:: 132235-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-110 from RABGAP1 (AAH54492) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1A8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: RABGAP1 may act as a GTPase-activating protein of RAB6A and play a role in microtubule nucleation by centrosome. It may participate in a RAB6A-mediated pathway involved in the metaphase-anaphase transition. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MDDQPGEKELVKRSQLDGEGDGPLSNQLSASSTINPVPLVGLQKPEMSLPVKPGQGDSEASSPFTPVADEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRSQCQISL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.