132138
PZR (Myelin Protein Zero-like Protein 1, Protein Zero-related, MPZL1, UNQ849/PRO1787)
Größe
£685.00
- SKU:
- 132138
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human MPZL1, aa1-269 (NP_003944.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- PZR (Protein zero related) is an immunoglobulin superfamily protein that specifically binds the tyrosine phosphatase SHP-2 through its intracellular immunoreceptor tyrosine-based inhibitory motifs (ITIMs). PZR is phosphorylated by c-Src, c-Fyn, c-Lyn, Csk, and c-Abl. PP1, a Src family kinase inhibitor, inhibits PZR phosphorylation. There are three alternatively spliced isoforms designated as PZR, PZRa, and PZRb; both PZRa and PZRb lack ITIMs. PZR is a main receptor of ConA and has an important role in cell signaling via c-Src. PZR is expressed in many cell types and is localized to cell contacts and intracellular granules in BAECs and mesothelioma (REN) cells. Recently, PZR has been implicated as a cell adhesion protein that may be involved in SHP-2-dependent signaling at interendothelial cell contacts. Hypertyrosine phosphorylation of PZR was observed during embryogenesis in a mouse model of Noonan Syndrome. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice