132088
PTRF (Polymerase I and Transcript Release Factor, CAVIN1, Cavin-1, CAVIN, CGL4, FKSG13)
Größe
£685.00
- SKU:
- 132088
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa233-321 from human PTRF with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1F7
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Applications: Suitable for use in ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (FFPE): 3ug/ml detects PTRF using immunoperoxidase staining on formalin fixed, paraffin embedded human pancreas. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: KKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFTPDHVVYARSKTAVYKVPPF* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice