132069
PTPN5 (STEP, Tyrosine-protein Phosphatase Non-receptor Type 5, Striatum-enriched Protein-tyrosine Phosphatase, Neural-specific Protein-tyrosine Phosphatase, FLJ14427)
Größe
£685.00
- SKU:
- 132069
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa388-487 from human PTPN5 (NP_116170) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2H5
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- STEP (striatum-enriched phosphatase) is a neural-specific protein-tyrosine phosphatase, first isolated from the rat brain. The 537aa predicted human protein as isolated from cDNA sequences is between 85 and 90% identical to the mouse and rat sequences. In rat neuronal cell cultures, glutamate-mediated activation of N-methyl-D-aspartate (NMDA) receptors leads to the rapid but transient phosphorylation of extracellular signal-related kinase-2 (ERK2). NMDA-mediated influx of calcium, activates the calcium-dependent phosphatase calcineurin and the resulting dephosphorylation and activation of STEP. STEP then inactivatea ERK2 through tyrosine dephosphorylation and blocks translocation of the kinase to the nucleus. STEP plays a significant role in regulating the ERK activation and downstream signaling in neurons. Applications: Suitable for use in ELISA and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: WQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice