132069-FITC

PTPN5 (STEP, Tyrosine-protein Phosphatase Non-receptor Type 5, Striatum-enriched Protein-tyrosine Phosphatase, Neural-specific Protein-tyrosine Phosphatase, FLJ14427) (FITC)

Größe

£914.00

SKU:: 132069-FITC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa388-487 from human PTPN5 (NP_116170) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2H5
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: STEP (striatum-enriched phosphatase) is a neural-specific protein-tyrosine phosphatase, first isolated from the rat brain. The 537aa predicted human protein as isolated from cDNA sequences is between 85 and 90% identical to the mouse and rat sequences. In rat neuronal cell cultures, glutamate-mediated activation of N-methyl-D-aspartate (NMDA) receptors leads to the rapid but transient phosphorylation of extracellular signal-related kinase-2 (ERK2). NMDA-mediated influx of calcium, activates the calcium-dependent phosphatase calcineurin and the resulting dephosphorylation and activation of STEP. STEP then inactivatea ERK2 through tyrosine dephosphorylation and blocks translocation of the kinase to the nucleus. STEP plays a significant role in regulating the ERK activation and downstream signaling in neurons. Applications: Suitable for use in FLISA and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: WQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEG Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice