132065

PTPN22 (Tyrosine-protein Phosphatase Non-receptor Type 22, Hematopoietic Cell Protein-tyrosine Phosphatase 70Z-PEP, Lymphoid Phosphatase, LyP, PEST-domain Phosphatase, PEP, PTPN8)

Größe

£685.00

SKU:: 132065
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant protein corresponding to aa1-179 from human PTPN22 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F6
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: ELISA: 1ng/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.