132047

PTMS (Parathymosin)

Größe

£685.00

SKU:: 132047
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-102, from human PTMS (AAH17025) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2D3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: PTMS may mediate immune function by blocking the effect of prothymosin alpha which confers resistance to certain opportunistic infections. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSEKSVEAAAELSAKDLKEKKEKVEEKASRKERKKEVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALKRAAEEEDEADPKRQKTENGASA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.