132014

PTF1A (Pancreas Transcription Factor 1 Subunit alpha, Pancreas-specific Transcription Factor 1a, Class A Basic Helix-loop-helix Protein 29, bHLHa29, bHLH Transcription Factor p48, p48 DNA-binding Subunit of Transcription Factor, PTF1, PTF1P48, PTF1-p48)

Größe

£685.00

SKU:: 132014
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa250-329 from human PTF1A (NP_835455) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1A2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody. Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml detects PTF1A using immunoperoxidase staining on formalin fixed paraffin embedded human esophagus. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: QAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.