132014-ML650

PTF1A (Pancreas Transcription Factor 1 Subunit alpha, Pancreas-specific Transcription Factor 1a, Class A Basic Helix-loop-helix Protein 29, bHLHa29, bHLH Transcription Factor p48, p48 DNA-binding Subunit of Transcription Factor, PTF1, PTF1P48, PTF1-p48) (MaxLight 650)

Größe

£914.00

SKU:: 132014-ML650
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa250-329 from human PTF1A (NP_835455) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1A2
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Weitere Details:: MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Sandwich FLISA: The detection limit is ~0.03ng/ml as a capture antibody. Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml detects PTF1A using immunoperoxidase staining on formalin fixed paraffin embedded human esophagus. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: QAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice