132011
PTEN (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and Dual-specificity Protein Phosphatase PTEN, Mutated in Multiple Advanced Cancers 1, Phosphatase and Tensin Homolog, MMAC1, TEP1, MGC11227)
Größe
£685.00
- SKU:
- 132011
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa221-320, from human PTEN (AAH05821) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2G9
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- The tumor suppressor phosphatase PTEN regulates cell migration, growth, and survival by dephosphorylating phosphatidylinositol second messengers and signaling phosphoproteins. PTEN protein is composed of an N-terminal dual specificity phosphatase-like enzyme domain and C-terminal noncatalytic regulatory domain that contains multiple putative phosphorylation sites, which could play an important role in the control of its biological activity. Proper phosphorylation of PTEN by CK2 is important for PTEN protein stability to proteasome-mediated degradation. The phosphorylation sites in PTEN are located within a C- terminal cluster of Ser/Thr residues. The CK2 phosphorylation sites were identified as PTEN residues Ser-370, Ser-380, Thr-382, Thr-383, and Ser-385. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice