131932-APC

Cytohesin 3 (Cytohesin-3, CYTH3, ARF Nucleotide-binding Site Opener 3, ARNO3, Protein ARNO3, General Receptor of Phosphoinositides 1, Grp1, PH, SEC7 and Coiled-coil Domain-containing Protein 3, PSCD3) (APC)

Größe

£927.00

SKU:: 131932-APC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-180 from PSCD3 (AAH08191) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6D3-1A9
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: Applications: Suitable for use in FLISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.