131921-HRP

PARL (Presenilins-associated Rhomboid-like Protein, Mitochondrial, Mitochondrial Intramembrane Cleaving Protease PARL, PSARL, PSARL1, PRO2207, PSENIP2, RHBDS1) (HRP)

Größe

£914.00

SKU:: 131921-HRP
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-101 from human PSARL (NP_061092) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Weitere Details:: Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: ELISA: 1ng/ml Optimal dilutions to be determined by the researcher. AA Sequence: AWRGWAQRGWGCGQAWGASVGGRSCEELTAVLTPPQLLGRRFNFFIQQKCGFRKAPRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.