131909

PRSS27 (MPN, Serine Protease 27, Marapsin, Pancreasin)

Größe

£685.00

SKU:: 131909
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa94-204 from human PRSS27 (NP_114154) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6F11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Pancreasin is a pancreatic tryptic serine peptidase that cleaves peptides after an arginine residue. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLPDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEFGY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.