PRPS1L1 (Phosphoribosyl Pyrophosphate Synthase 1-like 1, PRPS1-like 1, PRPSL, Ribose-phosphate Pyrophosphokinase 3, PRPS3, Phosphoribosyl Pyrophosphate Synthase III, PRS-III)

Größe

£685.00

SKU:: 131886
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa146-244 from human PRPS1L1 (NP_787082) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5E10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YAEPTVLKWIRENIPEWKNCIIVSPDAGGAKRVTSIADQLNVDFALIHKERKKANEVDCIVLVGDVNDRVAILVDDMADTCVTICLAADKLLSAGATR Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.