PRPH (Peripherin, Neurofilament 4, NEF4, PRPH1)

Größe

£685.00

SKU:: 131884
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa374-470 of human PRPH with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3B3
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Peripherin is a 57kD type III intermediate filament that is a specific marker for peripheral neurons, including enteric ganglion cells. Peripherin is expressed in the developing peripheral nervous system and is highly enriched in neuronal derivatives of the neural crest. Peripherin offers an advantage over other neural markers, such as S100 and NSE in that it does not stain chrmaffin cell types. Applications: Suitable for use in ELISA, Western Blot, Immunofluorescence and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.