PRPF31 (Pre-mRNA-processing Factor 31, U4/U6 Small Nuclear Ribonucleoprotein Prp31, PRP31, hPrp31, RP11, Serologically Defined Breast Cancer Antigen NY-BR-99, U4/U6 snRNP 61kD Protein, Protein 61K)

Größe

£685.00

SKU:: 131879
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa400-500 from human PRPF31 (NP_056444) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 8E1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.