131872
Proteinase-activated Receptor 1 (PAR-1, Coagulation Factor II Receptor, Thrombin Receptor, F2R, CF2R, PAR1, TR)
Größe
£685.00
- SKU:
- 131872
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa42-102 from human F2R (NP_001983.1) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2C5
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice