131867-ML490
Prostatic Acid Phosphatase (PAP, ACPP, ACP3, ACP-3, 5'-Nucleotidase, 5'-NT, Ecto-5'-nucleotidase, Thiamine Monophosphatase, TMPase) (MaxLight 490)
Größe
£914.00
- SKU:
- 131867-ML490
- Anwendung:
- FLISA
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa310-418 from human ACPP (AAH07460) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2D11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Respiratory syncytial virus (RSV) is the most significant respiratory pathogen of early development and causes about half of all cases of bronchiolitis and a quarter of all cases of pneumonia during the first few months of life. There are multiple types and subtypes of RSV. VP-R151 is a mixture of four antibodies to optimize sensitivity and detection of the various RSV forms. It does not cross- react with tissue culture isolates of influenza virus types A and B, parainfluenza virus types 1, 2, 3 and 4b, adeno- virus, herpes simplex virus types 1 and 2, varicella-zoster virus, cytomegalovirus, mumps virus, measles virus, ECHOvirus 19, coxsackie B4 virus, poliovirus types 1, 2 and 3 or negative tissue culture cells used in routine virus isolation. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELAGPVIPQDWSTECMTTNSHQVLKVIFAVAFCLISAVLMVLLFIHIRRGLCWQRESYGNI Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice