131867-HRP
Prostatic Acid Phosphatase (PAP, ACPP, ACP3, ACP-3, 5'-Nucleotidase, 5'-NT, Ecto-5'-nucleotidase, Thiamine Monophosphatase, TMPase) (HRP)
Größe
£914.00
- SKU:
- 131867-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa310-418 from human ACPP (AAH07460) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2D11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- Respiratory syncytial virus (RSV) is the most significant respiratory pathogen of early development and causes about half of all cases of bronchiolitis and a quarter of all cases of pneumonia during the first few months of life. There are multiple types and subtypes of RSV. VP-R151 is a mixture of four antibodies to optimize sensitivity and detection of the various RSV forms. It does not cross- react with tissue culture isolates of influenza virus types A and B, parainfluenza virus types 1, 2, 3 and 4b, adeno- virus, herpes simplex virus types 1 and 2, varicella-zoster virus, cytomegalovirus, mumps virus, measles virus, ECHOvirus 19, coxsackie B4 virus, poliovirus types 1, 2 and 3 or negative tissue culture cells used in routine virus isolation. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELAGPVIPQDWSTECMTTNSHQVLKVIFAVAFCLISAVLMVLLFIHIRRGLCWQRESYGNI Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice