PRODH (Proline Dehydrogenase 1, Mitochondrial, Proline Oxidase, Proline Oxidase 2, p53-induced Gene 6 Protein, PIG6, POX2, FLJ33744, MGC148078, MGC148079)

Größe

£685.00

SKU:: 131850
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa441-541, from human PRODH (NP_057419) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3A9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Converts proline to delta-1-pyrroline-5-carboxylate. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.