PPP2R5C (KIAA0044, Serine/Threonine-protein Phosphatase 2A 56kD Regulatory Subunit gamma Isoform, PP2A B Subunit Isoform B'-gamma, PP2A B Subunit Isoform B56-gamma, PP2A B Subunit Isoform PR61-gamma, PP2A B Subunit Isoform R5-gamma, Renal Carcinoma Antigen NY-REN-29, MGC23064)

Größe

£685.00

SKU:: 131722
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-100 from human PPP2R5C (NP_002710.2) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3G9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice