131694-FITC
PPP1R1B (Protein Phosphatase 1 Regulatory Subunit 1B, DARPP-32, Dopamine- and cAMP-regulated Neuronal Phosphoprotein, DARPP32, FLJ20940) (FITC)
Größe
£914.00
- SKU:
- 131694-FITC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-169 from human PPP1R1B (AAH01519) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3G11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- DARPP-32, a dopamine (DA) and cAMP-regulated ~32kD phosphoprotein that is associated with dopaminoceptive neurons bearing D-1 receptors in the basal ganglia. The protein inhibits protein phosphatase I when it is phosphorylated on Thr34. In contrast, when DARPP-32 is phosphorylated on Thr75 the protein acts as an inhibitor of PKA. Phosphorylation of DARPP-32 is thought to play a critical role in the regulation of dopaminergic neurotransmission. In addition, the activity of DARPP-32 is also thought to play important roles in the actions of alcohol, caffeine and Prozac®. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice