PPP1R10 (CAT53, FB19, PNUTS, Serine/Threonine-protein Phosphatase 1 Regulatory Subunit 10, MHC Class I Region Proline-rich Protein CAT53, PP1-binding Protein of 114kD, Phosphatase 1 Nuclear Targeting Subunit, Protein FB19, p99)

Größe

£685.00

SKU:: 131682
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-83 from human PPP1R10 (NP_002705.2) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: This gene encodes a protein with similarity to a rat protein that has an inhibitory effect on protein phosphatase-1 (PP1). The rat protein localizes to the nucleus and colocalizes with chromatin at distinct phases during mitosis. This gene lies within the major histocompatibility complex class I region on chromosome 6. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVGGYKLLNNWLTYSK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.