131655-FITC

PPFIBP2 (Liprin-beta-2, Protein Tyrosine Phosphatase Receptor Type F Polypeptide-interacting Protein-binding Protein 2, PTPRF-interacting Protein-binding Protein 2, DKFZp781K06126, MGC42541) (FITC)

Größe

£914.00

SKU:: 131655-FITC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-101 from PPFIBP2 (NP_003612) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3A5
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: May regulate the disassembly of focal adhesions. Did not bind receptor-like tyrosine phosphatases type 2A. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASDASHALEAALEQMDGIIAGTKTGADLSDGTCEPGLASPASYMNPFPVLHLIEDLRLALEMLELPQERAALLSQIPGPTAAYIKEWFEESLSQVNHHS* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.