131643-FITC
PPARGC1A (Peroxisome Proliferator-activated Receptor gamma Coactivator 1-alpha, PGC-1-alpha, PPAR-gamma Coactivator 1-alpha, PPARGC-1-alpha, Ligand Effect Modulator 6, LEM6, PGC1, PGC1A, PPARGC1) (FITC)
Größe
£914.00
- SKU:
- 131643-FITC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa689-798 from human PPARGC1A (NP_037393) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2F9
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- PGC1 beta (peroxisome proliferator-activated receptor gamma coactivator 1 beta), also known as PPARGC1B, is an 110kD protein that belongs to a family of PPAR coactivators. It coactivates nuclear receptors such as ERRalpha, upregulating expression of proteins that promote mitochondrial fusion and control basal mitochondrial biogenesis. N- and C-terminal alternate sequences, or deletion of aa156-194, produce isoforms of 984, 1017, 1023 (most common) and 1055aa. Human PGC1 beta aa315-420, which is common to all isoforms, shares 79% and 76% aa identity with mouse and rat PGC1 beta, respectively. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice