POU4F1 (POU Domain, Class 4, Transcription Factor 1, Brain Specific Homeobox/POU Domain Protein 3A, BRN3A, Brn-3a, Brn-3.0, Brn3, FLJ13449, Homeobox/POU Domain Protein RDC1, Oct-T1, RDC-1, FLJ13449)

Größe

£685.00

SKU:: 131626
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa331-421 from human POU4F1 (NP_006228) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 7B4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Brn-3C may play a role in determining or maintaining the identities of a small subset of visual system neurons. It is expressed in the brain and it seems to be specific to the retina. Defects in Brn-3C are the cause of non-syndromic sensorineural deafness autosomal dominant type 15 (DFNA15) which is a form of sensorineural hearing loss. Sensorineuraldeafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.