131626-BIOTIN
POU4F1 (POU Domain, Class 4, Transcription Factor 1, Brain Specific Homeobox/POU Domain Protein 3A, BRN3A, Brn-3a, Brn-3.0, Brn3, FLJ13449, Homeobox/POU Domain Protein RDC1, Oct-T1, RDC-1, FLJ13449) (Biotin)
Größe
£914.00
- SKU:
- 131626-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa331-421 from human POU4F1 (NP_006228) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 7B4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Brn-3C may play a role in determining or maintaining the identities of a small subset of visual system neurons. It is expressed in the brain and it seems to be specific to the retina. Defects in Brn-3C are the cause of non-syndromic sensorineural deafness autosomal dominant type 15 (DFNA15) which is a form of sensorineural hearing loss. Sensorineuraldeafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice