POMT2 (Protein O-mannosyl-transferase 2, Dolichyl-phosphate-mannose--protein Mannosyltransferase 2, DKFZp686G10254, FLJ22309, MDDGA2, MDDGB2, MDDGC2)

Größe

£685.00

SKU:: 131609
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa483-581 from human POMT2 (NP_037514) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Transfers mannosyl residues to the hydroxyl group of serine or threonine residues. Coexpression of both POMT1 and POMT2 is necessary for enzyme activity, expression of either POMT1 or POMT2 alone is insufficient. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: CVLGSSGKVLPKWGWEQLEVTCTPYLKETLNSIWNVEDHINPKLPNISLDVLQPSFPEILLESHMVMIRGNSGLKPKDNEFTSKPWHWPINYQGLRFS* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.