POLR3D (DNA-directed RNA Polymerase III Subunit RPC4, RNA Polymerase III Subunit C4, DNA-directed RNA Polymerase III Subunit D, Protein BN51, RNA Polymerase III 47kD Subunit, RPC53 Homolog, BN51, BN51T)

Größe

£685.00

SKU:: 131598
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa296-395 from human POLR3D with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4E6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: POLR3D is a DNA dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. It plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses and acts as nuclear and cytosolic DNA sensor involved in innate immune response. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.