131598-FITC
POLR3D (DNA-directed RNA Polymerase III Subunit RPC4, RNA Polymerase III Subunit C4, DNA-directed RNA Polymerase III Subunit D, Protein BN51, RNA Polymerase III 47kD Subunit, RPC53 Homolog, BN51, BN51T) (FITC)
Größe
£914.00
- SKU:
- 131598-FITC
- Anwendung:
- FLISA
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa296-395 from human POLR3D with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4E6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- POLR3D is a DNA dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. It plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses and acts as nuclear and cytosolic DNA sensor involved in innate immune response. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDH Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice