PNCK (Calcium/Calmodulin-dependent Protein Kinase Type 1B, CaM Kinase I beta, CaM Kinase IB, CaM-KI beta, CaMKI-beta, Pregnancy Up-regulated Non-ubiquitously-expressed CaM Kinase, BSTK3, FLJ50403, FLJ50549, FLJ56451, FLJ59811, MGC45419)

Größe

£685.00

SKU:: 131527
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human PNCK, aa1-121 (AAH33746.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. In vitro phosphorylates CREB1 and SYN1/synapsin I. Phosphorylates and activates CAMK1. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLLLKKHTEDISSVYEIRERLGSGPSPLHSLSLLPLLSSHFLPTSHRPVCGRGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMEL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.