131518-APC
PMP22 (Peripheral Myelin Protein 22, PMP-22, Growth Arrest-specific Protein 3, GAS-3, GAS3) (APC)
Größe
£927.00
- SKU:
- 131518-APC
- Anwendung:
- FLISA
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa25-114 from human PMP22 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3G10
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- Peripheral myelin protein 22 (PMP22) is a small, hydrophobic a tetraspan glycoprotein, with proposed roles in peripheral nerve myelin formation, cell-cell interactions, and cell proliferation. It is most prominently expressed by Schwann cells as a component of compact myelin of the peripheral nervous system (PNS), thus representing 2 to 5% of all myelin proteins. It is also observed in nonneural cells and tissues during development, such as in the epithelial cells of the lung and intestine. The human PMP-22 gene has been mapped to chromosome 17p11.2 and codes for a 22kD transmembrane glycoprotein. It plays a crucial role in normal physiological and pathological processes in the peripheral nervous system which includes correct myelination during development of peripheral nerves, the stability of myelin, and the maintenance of axons. Recent study revealed that genetic alterations in the PMP22 gene including duplications, deletions, and point mutations are responsible for the most common forms of hereditary peripheral neuropathies including Charcot-Marie-Tooth disease type 1A (CMT1A), hereditary neuropathy with liability to pressure palsies (HNPP), and a subtype of Dejerine-Sottas Syndrome (DSS). Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: VSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice