PLXDC2 (Plexin Domain-containing Protein 2, Tumor Endothelial Marker 7-related Protein, TEM7R, UNQ2514/PRO6003, FLJ14623)

Größe

£685.00

SKU:: 131506
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa29-108 from human PLXDC2 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4G10
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: May play a role in tumor angiogenesis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: DGKPGDQILDWQYGVTQAFPHTEEEVEVDSHAYSHRWKRNLDFLKAVDTNRASVGQDSPEPRSFTDLLLDDGQDNNTQIE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.