131503-FITC
PLUNC (BPIFA1, BPI Fold-containing Family A Member 1, Lung-specific Protein X, Nasopharyngeal Carcinoma-related Protein, Palate Lung and Nasal Epithelium Clone Protein, Secretory Protein in Upper Respiratory Tracts, Tracheal Epithelium-enriched Protein, Von Ebner Protein Hl, LUNX, NASG, SPURT, UNQ787/PRO1606, bA49G10.5, LPLUNC3) (FITC)
Größe
£914.00
- SKU:
- 131503-FITC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-257 from human PLUNC (AAH12549) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3C1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- May be involved in the airway inflammatory response after exposure to irritants. May be associated with tumor progression. May play a role in innate immune responses of the upper airways. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice