PLGF (Placenta Growth Factor, Placental Growth Factor, PGF, PGFL, D12S1900, PlGF-2, SHGC-10760)

Größe

£685.00

SKU:: 131472
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human PGF, aa1-170 (NP_002623.2).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Placenta growth factor belongs to the PDGF/VEGF growth factor family. It is a secreted N-glycosylated protein with roles in angiogenesis and endothelial cell growth. At least 3 isoforms are produced by alternative splicing; PIGF-1, PIGF-2 and PIGF-3. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.