PLEKHS1 (C10orf81, Pleckstrin Homology Domain-containing Family S Member 1, PH Domain-containing Family S Member 1, Epididymis Luminal Protein 185, hEL185, C10orf81, FLJ23537)

Größe

£685.00

SKU:: 131468
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant protein corresponding to aa1-282 from human C10orf81 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3B6
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: C10orf81 contains 1 PH domain. There are 5 named isoforms produced by alternative splicing. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amno Acid Sequence: MEQSSPGFRQTHLQDLSEATQDVKEENHYLTPRSVLLELDNIIASSDSGESIETDGPDQVSGRIECHYEPMESYFFKETSHESVDSSKEEPQTLPETQDGDLHLQEQGSGIDWCLSPADVEAQTTNDQKGSASLTVVQLSILINNIPDESQVEKLNVFLSPPDVINYLALTEATGRICVSQWEGPRRLGCIFCHGDHLLAVNDLKPQSLEEVSLFLTRSIQKEKLKLTIGRIPNSETFHAASCMCPSKCQSAAPSQLDKPRLNRAPKRSPAIKKSQQKGARE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap