PLEKHM1 (Pleckstrin Homology Domain-containing Family M Member 1, PH Domain-containing Family M Member 1, 162kD Adapter Protein, AP162, KIAA0356, OPTB6)

Größe

£685.00

SKU:: 131460
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa957-1056 from PLEKHM1 (AAH64361) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1C9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Involved in vesicular transport in the osteoclast. May have a role in sialyl-lex-mediated transduction of apoptotic signals. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PHRFSVADLQQIADGVYEGFLKALIEFASQHVYHCDLCTQRGFICQICQHHDIIFPFEFDTTVRCAECKTVFHQSCQAVVKKGCPRCARRRKYQEQNIFA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.