PLDN (Biogenesis of Lysosome-related Organelles Complex 1 Subunit 6, BLOC-1 Subunit 6, Pallid Protein Homolog, Pallidin, Syntaxin 13-interacting Protein, BLOC1S6, PA)

Größe

£685.00

SKU:: 131445
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-100 from human PLDN (NP_036520) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2H8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSML* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.