PLAGL1 (Zinc Finger Protein PLAGL1, Lost on Transformation 1, LOT-1, Pleiomorphic Adenoma-like Protein 1, Tumor Supressor ZAC, LOT1, ZAC, DKFZp781P1017, MGC126275, MGC126276)

Größe

£698.00

SKU:: 131431
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa221-321 from human PLAGL1 (NP_002647) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1E2
Format:: Supplied as a liquid in ascites fluid.
Weitere Details:: Shows weak transcriptional activatory activity. Transcriptional regulator of the type 1 receptor for pituitary adenylate cyclase-activating polypeptide. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVNLPKELPADAVNL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.