131408-BIOTIN
PKNOX2 (PREP2, Homeobox Protein PKNOX2, Homeobox Protein PREP-2, PBX/Knotted Homeobox 2, FLJ13074) (Biotin)
Größe
£914.00
- SKU:
- 131408-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa116-216 from human PKNOX2 (NP_071345) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4B6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Homeodomain proteins are sequence-specific transcription factors that share a highly conserved DNA-binding domain and play fundamental roles in cell proliferation, differentiation, and death. PKNOX2 belongs to the TALE (3aa loop extension) class of homeodomain proteins characterized by a 3aa extension between alpha helices 1 and 2 within the homeodomain (Imoto et al., 2001 [PubMed 11549286]). Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCFKTKMHSDNLLRNDLGGPYSPNQPSINLHSQDLLQNSPNSMSGVSNNPQGIVVPASALQQGN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice